Using (Local)ColabFold on O2

Using (Local)ColabFold on O2

ColabFold (GitHub - sokrypton/ColabFold: Making Protein folding accessible to all! ) is an emerging protein folding prediction tool based on Google DeepMind’s Alphafold (see Using AlphaFold 2 on O2 ). LocalColabFold (GitHub - YoshitakaMo/localcolabfold: ColabFold on your local PC ) is a packaging of ColabFold for use on local machines; we provide instructions on how to leverage LocalColabFold on O2 below. LocalColabFold uses MMseqs2 (conditionally faster than jackhmmer), and runs AlphaFold2 for single protein modeling and AlphaFold-Multimer for protein complex modeling. If you are unsure about which to use, feel free to try both tools and compare results. O2’s colabfold module is loosely based on Localcolabfold’s deployment methods.

Note: If you’re new to Slurm or O2, please see Using Slurm Basic for lots of information on submitting jobs.

 

Using the Module

As of the current module (colabfold/1.5.5-8c55fc2), ColabFold does NOT support AlphaFold 3. For information on how to access and use AlphaFold 3, please refer to Using AlphaFold 3 on O2 .

ColabFold is available via our LMOD module system (Using Applications on O2 ).

The default behavior of the tool is to send proteins to the remote server for alignment before returning to leverage the local GPU resource, this should only be used for small queries. We recommend processing “large” volumes of proteins by creating MSAs locally (see Using (Local)ColabFold on O2 | Generating MSAs Using Local MMseqs2 below). See the Caveats section for more information.

To identify available versions:

$ module spider colabfold

To access the module (for example, colabfold/1.5.5-8c55fc2):

$ module load colabfold/1.5.5-8c55fc2

A snapshot of the help text follows:

$ module help colabfold/1.5.5-8c55fc2 --------------------------------- Module Specific Help for "colabfold/1.5.5-8c55fc2" --------------------------------- This module is loosely based on https://github.com/YoshitakaMo/localcolabfold For instructions, refer to: https://github.com/sokrypton/colabfold This module is based on the 8c55fc2548823d57bb23c24a6b2573348e6d51c8 commit of the colabfold repository. Databases are located at `/n/shared_db/colabfold/1.5.5-8c55fc2`, and were generated using scripts provided by colabfold running mmseqs from mmseqs2/17-b804f.

This output shows the last time the module was updated. ColabFold has developed quickly at times. If you are looking for a bleeding edge version of ColabFold, you can install your own copy (Installing LocalColabFold Locally | Installing LocalColabFold) and manually keep it up to date.

Generating MSAs Using Local MMseqs2

Generating MSAs locally using MMseqs2 reduces the load on remote servers managed by Colabfold developers, and allows users to run larger batches without risk of being limited (see Using (Local)ColabFold on O2 | Caveats ). MMseqs2 can be loaded from within the ColabFold module:

$ module load colabfold/1.5.5-8c55fc2 $ module list Currently Loaded Modules: 1) mmseqs2/17-b804f 2) colabfold/1.5.5-8c55fc2 (E) Where: E: Experimental

Parameters for using MMseqs2 through the command colabfold_search are revealed by loading the modules above in an interactive session:

$ colabfold_search -h

MMseqs2 accepts .fasta files containing multiple amino acid sequences as input,

>firstfastasequencename MWELRSIAFSRAVFAEFLATLLFVFFGLGSALNWPQALPS >secondfastasequencename CSMNPARSLAPAVVTGKFDDHWVFWIGPLVGAILGSLLYN

including complexes where proteins are separated with a colon (:).

>firstxsecondcomplex MWELRSIAFSRAVFAEFLATLLFVFFGLGSALNWPQALPS:CSMNPARSLAPAVVTGKFDDHWVFWIGPLVGAILGSLLYN

These inputs can contain a single sequence, or a "batch" of several proteins as input. The path to this file should be included in a colabfold_search command. We have public databases available in /n/shared_db/ (Public Databases) and we will use these for database paths in the simplified examples below:

#Version 17-b804f (loaded with colabfold/1.5.5-8c55fc2) colabfold_search \ --db-load-mode 2 \ --mmseqs mmseqs \ --use-env 1 \ --use-templates 0 \ --threads 3 \ /PATH/TO/INPUT.fasta /n/shared_db/colabfold/1.5.5-8c55fc2 /PATH/TO/OUTPUT/DIRECTORY

If you are trying to access older versions of databases, investigate the use of the --db1, --db2, --db3, and --db4 flags. You can view what these flags do by invoking colabfold_search -h. If your older database still will not parse, you may need to install an older version of mmseqs2 - Research Computing can assist with this as necessary.

These commands can be combined with a sbatch (Using Slurm Basic | The sbatch command ) script. The resources required to complete a LocalColabFold job may vary by structure and complexity. It is generally best to start with a relatively conservative request for resources, then increase as needed based on information from past jobs. This information can be found using commands like O2_jobs_report (Get information about current and past jobs | O2_jobs_report ). Below is a simplified example of an sbatch script that runs the file INPUT.fasta against colabfold_search on the short partition:

#!/bin/bash #SBATCH -c 4 # Requested cores #SBATCH --time=0-12:00 # Runtime in D-HH:MM format #SBATCH --partition=short # Partition to run in #SBATCH --mem=24GB # Requested Memory #SBATCH -o %j.out # File to which STDOUT will be written, including job ID (%j) #SBATCH -e %j.err # File to which STDERR will be written, including job ID (%j) #SBATCH --mail-type=ALL # ALL email notification type #SBATCH --mail-user=<email_address> # Email to which notifications will be sent module load colabfold/1.5.5-8c55fc2 colabfold_search \ --db-load-mode 2 \ --mmseqs mmseqs \ --use-env 1 \ --use-templates 0 \ --threads 4 \ /PATH/TO/INPUT.fasta /n/shared_db/colabfold/1.5.5-8c55fc2 /PATH/TO/OUTPUT/DIRECTORY

The output should include MSAs in .a3m format. These can be submitted to LocalColabFold as input in the next section, similar to a FASTA file.

Additional Considerations

As of the mmseqs2/17-b804f module version, mmseqs2 now supports generating MSAs on GPU resources, which may result in significant performance improvements (as well as not needing to wait for the remote server to return a payload). With Any version of ColabFold loaded, simply invoke colabfold_search with the --gpu 1 parameter. Obviously, this requires access to a GPU resource, which requires submission to a GPU-enabled partition. Note that in this case, --gpu 1 means “yes, use GPU” and NOT “use ONE GPU” - if this flag is specified, by default it will attempt to use all available GPUs in the job allocation, via the CUDA_VISIBLE_DEVICES environment variable. It is strongly discouraged to modify this variable.

Additionally, as of the colabfold/1.5.5-0e2a4b6 version, colabfold_search can now output AlphaFold3-compatible alignment files. Simply pass the --af3-json flag to colabfold_search when executing it after having loaded this version of ColabFold. There is also the flag --af3-msa-as-path for multiple alignment file outputs. See colabfold_search -h for more information.

For more information about this, please refer to GitHub - sokrypton/ColabFold: Making Protein folding accessible to all! . O2-specific usage examples are forthcoming. Please contact CCB (Core for Computational Biomedicine, ccbhelp@hms.harvard.edu) if having difficulties adapting the instructions on the repository website.

Executing ColabFold On O2

ColabFold can be loaded as a module by running:

$ module load colabfold/1.5.5-8c55fc2

Once you have loaded these modules, you’ll want to submit your job to the gpu (or gpu_quad if you have access) partition so that you can leverage GPU resources (Using O2 GPU resources ). Parameters for using LocalColabFold through the command colabfold_batch can be shown by loading the modules above in an interactive session (Using Slurm Basic | Interactive Sessions ) and running:

$ colabfold_batch -h

At the moment, we do not recommend invoking ‘--amber’ or ‘--templates’ flags since these lead some jobs to fail

ColabFold accepts both .a3m and .fasta files containing amino acid sequences, including complexes where proteins are separated with a colon (:). These inputs can contain a single sequence, or a "batch" of several proteins as input. The path to this file should be included in a colabfold_batch command. Below is a simplified example of a colabfold_batch command (graciously provided by the Center for Computational Biomedicine):

$ colabfold_batch --num-recycle 5 \ --model-type auto \ --rank auto \ /PATH/TO/INPUT \ /PATH/TO/DATABASES \ /PATH/TO/OUTPUT/DIRECTORY

Similar to the previous scripts mentioned, it is best to start with a modest resource request and slowly increase as needed. Below is a simplified example of a sbatch script that runs the file INPUT.fasta against colabfold_batch on the gpu partition:

#!/bin/bash #SBATCH --partition=gpu # Partition to run in #SBATCH --gres=gpu:1 # GPU resources requested #SBATCH -c 1 # Requested cores #SBATCH --time=0-12:00 # Runtime in D-HH:MM format #SBATCH --mem=128GB # Requested Memory #SBATCH -o %j.out # File to which STDOUT will be written, including job ID (%j) #SBATCH -e %j.err # File to which STDERR will be written, including job ID (%j) #SBATCH --mail-type=ALL # ALL email notification type #SBATCH --mail-user=<email_address> # Email to which notifications will be sent module load colabfold/1.5.5-8c55fc2 colabfold_batch --num-recycle 5 \ --model-type auto \ --rank auto \ /PATH/TO/INPUT \ /n/shared_db/colabfold/1.5.5-8c55fc2 /PATH/TO/OUTPUT/DIRECTORY

ColabFold does NOT support multiple GPUs. Please refrain from requesting more than one GPU per colabfold_batch invocation, as this will not speed up your run time, and will inhibit your ability to have your job dispatched in a timely manner.

The output directory will contain several .pdb, .json, and .png files for the predicted complex structure. This includes pLDDT and PAE metrics that assess the accuracy of each prediction. The 'best' ranked structure will be called {sample_id}_unrelaxed_rank_1_model_{i}.pdb .

Caveats

LocalColabFold is a repackaging of ColabFold for local use. This means that LocalColabFold requires all the same local hardware resources and connections that ColabFold would require (but without the Google Colab soft dependency). This includes the allowing of shipping the protein sequence to a remote server maintained by the ColabFold developers for processing during the alignment step. This server is shared by all users of ColabFold, and is not an HPC environment to our knowledge. This means that LARGE BATCHES OF PROTEIN ALIGNMENTS MUST BE GENERATED LOCALLY USING MMSEQS2, regardless of whether you are using the O2 module or your own installation on O2. At this time, the developers define large as “a few thousand” sequences. This could change, and is at the discretion of the system administrators maintaining the remote server. Please be considerate of other ongoing analysis on O2 when submitting large queries.

Large volumes of submissions to the remote server may cause the submitting compute node’s IP address to be rate-limited, or even blacklisted, which will impact all users of LocalColabFold on O2 that land on that compute node. Furthermore, because there are a limited number of compute nodes with GPU resources, if volume is high enough, all of O2’s GPU compute nodes can easily be blacklisted in a short amount of time.

Troubleshooting/FAQ

Errors with using --amber or --templates

As noted above, occasionally jobs will fail if either of the above flags are enabled - this is a known issue and requires action from the ColabFold developers. For now, simply resubmit the job without these flags, or if these functions are required for your work, you can also try submitting your sequences against Alphafold (and adjust your resource requirements accordingly).

Please contact rchelp@hms.harvard.edu with any questions regarding the module or troubleshooting the installation process that this section does not address or addresses insufficiently. Depending on the question, we may need to refer you to the developers, but we will do our best to assist.

My jobs are unable to detect GPUs and crash, CUDA_ERROR_NOT_FOUND error

This section refers to errors that look something like this:

2024-07-15 08:39:57.833390: E external/org_tensorflow/tensorflow/compiler/xla/stream_executor/cuda/cuda_driver.cc:628] failed to get PTX kernel "shift_right_logical" from module: CUDA_ERROR_NOT_FOUND: named symbol not found 2024-07-15 08:39:57.833441: E external/org_tensorflow/tensorflow/compiler/xla/pjrt/pjrt_stream_executor_client.cc:2153] Execution of replica 0 failed: INTERNAL: Could not find the corresponding function

Make sure you are submitting to a GPU-enabled partition and are requesting a GPU resource (see Using O2 GPU resources ).

Invalid database read error

This error takes the form:

[...] Invalid database read for database data file=/n/shared_db/colabfold/1.5.5-8c55fc2/uniref30_2302_db.idx, database index=/n/shared_db/colabfold/1.5.5-8c55fc2/uniref30_2302_db.idx.index [...]

In the colabfold/1.5.5-8c55fc2 module, there is an issue where due to certain oversights in the database generation instructions provided by the developers in order to enable GPU alignment functionality, the databases associated with this module are compatible with GPU only. To continue using this module to perform local alignments, it is necessary to request a GPU resource (e.g., submit a job to a GPU-enabled partition) and specify --gpu 1 to the colabfold_search command.

Alternatively, a new version is available which has databases that are compatible with both CPU and GPU, colabfold/1.5.5-0e2a4b6. It is recommended to switch to this version instead.